Everything below concerns Freeze-thaw cycle. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-06-07. Where a claim depends on a specific study, the study is described rather than over-claimed.
After a solvent is added, the vial is typically swirled or gently inverted rather than shaken vigorously. Shaking can introduce air and shear forces that promote foaming or aggregation, especially for longer peptides. Dissolution may take several minutes, and the solution should become clear unless the peptide is intentionally in suspension. Concentration is calculated from the mass of peptide stated on the vial label divided by the total liquid volume. If the dried peptide contains salts or counterions, the actual peptide content may be lower than the nominal mass.
Reconstitution is the process of adding a liquid to a lyophilized peptide so that the dried material dissolves into solution. Lyophilization removes water from a frozen peptide preparation under reduced pressure, leaving a porous solid or powder. The dried form often has greater long-term stability than a liquid because hydrolysis and oxidation are slowed. In laboratory work, reconstitution is usually the first step before dilution, analysis, or further experiments. The result is a stock solution whose concentration depends on the volume of solvent added and the amount of peptide in the vial.
Solvent choice depends on the peptide's sequence, charge, and solubility profile. Sterile water is common for freely soluble peptides, while aqueous buffers or dilute acid or base may be needed for others. Some sequences contain hydrophobic regions that resist water alone and require a small amount of organic co-solvent. The solvent's pH can affect charge state, aggregation, and stability. Because peptides vary widely, no single universal reconstitution liquid exists, and suppliers often provide a recommended solvent based on testing of a specific lot or sequence.
Storage recommendations for reconstituted peptides vary by sequence and intended use, so general rules remain broad. A common laboratory practice is to keep solutions cold, sometimes frozen, and protected from light, but freezing itself can damage certain peptides. The pH of the solution may be adjusted to a range where the peptide is most stable, though changing pH can also alter solubility. Documentation of reconstitution date, solvent, concentration, and storage conditions supports reproducibility. Stability data for a specific peptide are generally established by direct measurement rather than assumed from related compounds.
Once a peptide is in solution, its stability depends on temperature, pH, ionic strength, and the presence of oxygen or light. Many peptides are less stable in liquid form than as dry powders because hydrolysis, oxidation, and aggregation can proceed faster in water. Storage at low temperature slows these reactions but does not eliminate them. Some sequences are particularly sensitive to repeated freezing and thawing, which can cause precipitation or conformational changes. The container material and headspace also influence adsorption and surface-induced aggregation.
| Property | Value | Notes |
|---|---|---|
| Physical state before solvent | Lyophilized powder or cake | Freeze-drying removes water under vacuum and leaves a porous solid. |
| Common reconstitution liquid | Sterile water or aqueous buffer | Compatibility depends on peptide sequence, charge, and pH requirements. |
| Typical solution pH | pH 3 to 7 | Acidic or slightly acidic conditions are common; some peptides need other ranges. |
| Appearance after dissolution | Clear to slightly opalescent solution | Cloudiness can indicate incomplete dissolution, aggregation, or undissolved excipients. |
| Concentration basis | Mass of peptide per volume of solvent | Label mass may include counterions or salts, so peptide content can differ. |
Concentration calculations depend on the amount of peptide present in the vial and the volume of solvent added. Lyophilized preparations often contain counterions, salts, or residual water, so the labeled mass may not equal the mass of the peptide itself. This difference can produce a calculated concentration that is higher than the true peptide concentration. Analytical determination of peptide content, rather than reliance on the vial label alone, reduces this source of error. Uncertainty in volume measurement also contributes, especially when small liquid volumes are handled.
Quality records typically include a certificate of analysis, batch number, molecular weight, purity result, and recommended storage conditions. After reconstitution, a laboratory log may record solvent, final volume, date, and storage location. Such documentation supports reproducibility and allows later investigation if a preparation behaves unexpectedly. Stability studies often examine purity and concentration over time under defined temperatures, but results are not universally transferable between peptides or formulations. Open questions remain about how best to predict aggregation for specific sequences and how much analytical testing is sufficient for routine laboratory work.
After a peptide is reconstituted, analytical checks can confirm identity, concentration, and purity. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry provides a mass value that supports sequence identity, while ultraviolet absorbance at 214 or 280 nanometers is often used for concentration estimation when the extinction coefficient is known. These methods answer different questions and are complementary. A single measurement rarely establishes full quality, because the same sample can appear acceptable by one method and fail another.
Once a peptide is dissolved, its solution is generally less stable than the dry powder. Chemical pathways such as hydrolysis, oxidation, and deamidation can alter the molecule, while physical processes can form aggregates or cause adsorption to container walls. The rate depends on pH, buffer composition, temperature, concentration, and the specific sequence. Aqueous stocks are therefore kept cold and used within a defined period. Stability testing is usually performed for each peptide rather than assumed from a general rule.
Cold storage slows most degradation but does not stop it. Reconstituted solutions are commonly divided into aliquots and held at -20 °C or -80 °C, depending on the peptide. Repeated freeze-thaw cycles can promote aggregation or precipitation, so single-use aliquots are preferred. Some peptides tolerate refrigeration for short intervals, while others require freezing immediately. Light-sensitive residues may need amber or foil-wrapped containers. The optimal condition remains peptide-specific and should be supported by stability data.
Another strategy for site-specific amine conjugation to proteins is to replace lysine residues with arginine residues (LDVs). If all lysines are depleted then the only remaining free amine is at the amino terminus (N-terminus) of the protein. In the case where the protein is an antibody Fc domain, a recombinant LDV Fc can still be purified using protein A. LDV Fc proteins fused with short peptide targeting sequences can be used to deliver conjugated payloads, including nanoparticles, to specific cell surface proteins. The majority of ADCs under development or in clinical trials are for oncological and hematological indications. This is primarily driven by the inventory of monoclonal antibodies, which target various types of cancer. However, some developers are looking to expand the application to other important disease areas.
At the present time the Department promotes various scientific fields, running the whole gamut of base branches of classical physical chemistry: thermodynamics, kinetics, electrochemistry, catalysis, sorption processes. As the subjects of research, organic compounds unite all the aforesaid research areas. Over the last years staff members of the Department of Physical Chemistry made reports at conferences in many countries of the world: Canada, Poland, Republic of South Africa, Italy, Germany, Portugal, Czech Republic, USA, Ireland, Croatia, Spain, Sweden, Japan, Brazil. The head of the Department is Professor Boris N. Solomonov, Doctor of Science in Chemistry. The Department conducts research in the following fields:
HA (aq) + H2O (l) ⇌ H3O+ (aq) + A− (aq) Ka Common examples of monoprotic acids in mineral acids include hydrochloric acid (HCl) and nitric acid (HNO3). On the other hand, for organic acids the term mainly indicates the presence of one carboxylic acid group and sometimes these acids are known as monocarboxylic acid. Examples in organic acids include formic acid (HCOOH), acetic acid (CH3COOH) and benzoic acid (C6H5COOH). Polyprotic acids, also known as polybasic acids, are able to donate more than one proton per acid molecule, in contrast to monoprotic acids that only donate one proton per molecule. Specific types of polyprotic acids have more specific names, such as diprotic (or dibasic) acid (two potential protons to donate), and triprotic (or tribasic) acid (three potential protons to donate). Some macromolecules such as proteins and nucleic acids can have a very large number of acidic protons. A diprotic acid (here symbolized by H2A) can undergo one or two dissociations depending on the pH. Each dissociation has its own dissociation constant, Ka1 and Ka2.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acid–base extraction is a subclass of liquid–liquid extractions and involves the separation of chemical species from other acidic or basic compounds. It is typically performed during the work-up step following a chemical synthesis to purify crude compounds and results in the product being largely free of acidic or basic impurities. A separatory funnel is commonly used to perform an acid-base extraction. Acid-base extraction utilizes the difference in solubility of a compound in its acid or base form to induce separation. Typically, the desired compound is changed into its charged acid or base form, causing it to become soluble in aqueous solution and thus be extracted from the non-aqueous (organic) layer. Acid-base extraction is a simple alternative to more complex methods like chromatography. It is not possible to separate chemically similar acids or bases using this simple method.
Sources: en.wikipedia.org
RCO2H + R'2NH → RCO−2 + R'2NH+2 RCO−2 + R'2NH+2 → RC(O)NR'2 + H2O Esters are far superior substrates relative to carboxylic acids. Further "activating" both acid chlorides (Schotten-Baumann reaction) and anhydrides (Lumière–Barbier method) react with amines to give amides: RCO2R" + R'2NH → RC(O)NR'2 + R"OH RCOCl + 2R'2NH → RC(O)NR'2 + R'2NH+2Cl− (RCO)2O + R'2NH → RC(O)NR'2 + RCO2H Peptide synthesis use coupling agents such as HATU, HOBt, or PyBOP. The hydrolysis of nitriles is conducted on an industrial scale to produce fatty amides. Laboratory procedures are also available. Many specialized methods also yield amides. A variety of reagents, e.g. tris(2,2,2-trifluoroethyl) borate have been developed for specialized applications. Amidogen Amino radical Imidic acid Metal amides IUPAC Compendium of Chemical Terminology
Alcohol dehydrogenase class-3 is an enzyme that in humans is encoded by the ADH5 gene. This gene encodes glutathione-dependent formaldehyde dehydrogenase or the class III alcohol dehydrogenase chi subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class III alcohol dehydrogenase is a homodimer composed of 2 chi subunits. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis.
2-Hydroxybutyrate, the conjugate base of 2-hydroxybutyric acid, is produced in mammalian tissues (principally hepatic) that catabolize L-threonine or synthesize glutathione. Oxidative stress or detoxification demands can dramatically increase the rate of hepatic glutathione synthesis. Under such metabolic stress conditions, supplies of L-cysteine for glutathione synthesis become limiting, so homocysteine is diverted from the transmethylation pathway forming methionine into the transsulfuration pathway forming cystathionine. 2-Hydroxybutyrate is released as a byproduct when cystathionine is cleaved to cysteine that is incorporated into glutathione. Chronic shifts in the rate of glutathione synthesis may be reflected by urinary excretion of 2-hydroxybutyrate. α-hydroxybutyrate may be useful as an early indicator of insulin resistance in non-diabetic subjects. Moreover, elevated serum α-hydroxybutyrate predicts worsening glucose tolerance.
Acta Biochimica et Biophysica Sinica (ABBS) is a peer-reviewed scientific journal which publishes original research articles, short communications, and reviews in the fields of biochemistry and biophysics. Established in 1958, the journal is sponsored by the Institute of Biochemistry and Cell Biology, an institute of the Chinese Academy of Sciences, and is published monthly by Oxford Journals and was published by Blackwell Publishing prior to January 2009. This journal is indexed in the following databases: Science Citation Index Expanded Zoological Record BIOSIS Previews Chemical Abstracts Service – CASSI Index medicus MEDLINE PubMed
Sources: en.wikipedia.org
H3O+(aq) + Cl−(aq) + NH3 → Cl−(aq) + NH+4(aq) + H2O HCl(benzene) + NH3(benzene) → NH4Cl(s) HCl(g) + NH3(g) → NH4Cl(s) As with the acetic acid reactions, both definitions work for the first example, where water is the solvent and hydronium ion is formed by the HCl solute. The next two reactions do not involve the formation of ions but are still proton-transfer reactions. In the second reaction hydrogen chloride and ammonia (dissolved in benzene) react to form solid ammonium chloride in a benzene solvent and in the third gaseous HCl and NH3 combine to form the solid.
The characterization of the caspases allowed the development of caspase inhibitors, which can be used to determine whether a cellular process involves active caspases. Using these inhibitors, it was discovered that cells can die while displaying a morphology similar to apoptosis without caspase activation. Later studies linked this phenomenon to the release of AIF (apoptosis-inducing factor) from the mitochondria and its translocation into the nucleus mediated by its nuclear localization signal (NLS). Inside the mitochondria, AIF is anchored to the inner membrane. In order to be released, the protein is cleaved by a calcium-dependent calpain protease. Anoikis Apaf-1 Apo2.7 Apoptotic DNA fragmentation Atromentin induces apoptosis in human leukemia U937 cells. Autolysis Autophagy Cisplatin Cytotoxicity Entosis Ferroptosis Homeostasis Immunology Necrobiosis Necrosis Necrotaxis Nemosis Mitotic catastrophe p53 Paraptosis Pseudoapoptosis PI3K/AKT/mTOR pathway Ruptosis
There are three amino acids with side chains that are cations at neutral pH: arginine (Arg, R), lysine (Lys, K) and histidine (His, H). Arginine has a charged guanidino group and lysine a charged alkyl amino group, and are fully protonated at pH 7. Histidine's imidazole group has a pKa of 6.0, and is only around 10% protonated at neutral pH. Because histidine is easily found in its basic and conjugate acid forms it often participates in catalytic proton transfers in enzyme reactions.
Sources: en.wikipedia.org
Reconstitution means adding a liquid to a dried peptide to form a solution. The dried material is usually a lyophilized powder or cake produced by freeze-drying. The resulting liquid is a stock solution that can be diluted or analyzed further.
Freeze-drying removes water and limits hydrolysis and oxidation during storage. The dried solid is generally more stable and easier to ship than a liquid. It also allows a defined amount of material to be sealed in a single vial.
No. Solubility depends on the amino acid sequence, charge, and hydrophobic content. Some peptides require buffer, dilute acid, dilute base, or a small amount of organic solvent. A supplier's recommended solvent is based on the specific peptide.
Storage time depends on peptide sequence, concentration, solvent, and temperature. No single shelf life applies to all peptides. Stability should be determined by analytical testing for the specific preparation.