Everything below concerns aqueous solvent. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-05-01. Numbers and descriptions here follow the published literature rather than marketing material.
Reconstitution is the process of dissolving a lyophilized peptide powder in a suitable liquid to produce a solution for laboratory or clinical use. The dry powder is typically a porous cake or fluffy solid formed by freeze-drying an aqueous or mixed-solvent preparation. Adding solvent restores the peptide to a dissolved state, but the result is not necessarily identical to the original pre-lyophilization solution. Factors such as pH, ionic strength, temperature, and the peptide's sequence influence how completely and quickly dissolution occurs. The term is distinct from dilution, which lowers concentration without changing the physical state of an already dissolved material.
Solvent selection depends on the peptide's charge, hydrophobicity, and intended application. Many lyophilized peptides dissolve readily in water, while others require a small amount of a miscible organic solvent, a dilute acid, or a dilute base before aqueous dilution. A buffer may be used when a stable pH range is known, but adding buffer salts can also promote aggregation or precipitation. Dissolution should be observed rather than assumed, because a clear solution does not prove that the peptide is monomeric or fully active. The order of solvent addition and the final volume matter for achieving the intended concentration.
Lyophilization removes water from a peptide solution under vacuum, leaving a porous cake or a loose powder. The dry form often improves stability during shipping and storage because water-mediated degradation slows. Reconstitution reverses the process by adding a solvent so peptide molecules hydrate and enter solution. Complete dissolution depends on peptide sequence, purity, salt form, and any excipients present. Some lyophilized powders dissolve quickly, while others form haze, gels, or persistent particles.
Solvent selection affects pH, ionic strength, and preservative content in the final liquid. Sterile water and bacteriostatic water containing benzyl alcohol are common in laboratory settings. Buffer systems may be used when a peptide is sensitive to pH shifts during dissolution. Acidic or basic conditions can change the net charge of ionizable groups and therefore solubility. Organic cosolvents are sometimes added for hydrophobic sequences, though they can also promote unfolding or aggregation.
During reconstitution, solvent penetrates the powder, breaks interparticle contacts, and solvates polar and nonpolar groups. Gentle mixing or swirling can speed dissolution, while vigorous shaking may introduce foaming and surface denaturation. Aggregation becomes more likely when the peptide concentration exceeds its solubility or when the pH is near the isoelectric point. The link between a specific reconstitution method and long-term stability is not fully predictable from sequence alone. How excipients, container surfaces, and residual moisture influence aggregation remains an open question.
| Property | Value | Notes |
|---|---|---|
| Physical state before reconstitution | Lyophilized powder or cake | Appearance varies from fluffy to compact; not a solution. |
| Common solvent | Sterile or ultrapure water | Many peptides dissolve, but solubility is sequence-dependent. |
| Alternative solvent | Dilute acetic acid or acetonitrile/water | Used for hydrophobic or basic peptides; compatibility varies. |
| Typical storage after reconstitution | 2–8 °C short term; −20 °C or below for aliquots | Stability is peptide-specific; avoid repeated freeze-thaw. |
| Common analytical method | Reverse-phase HPLC | Assesses purity and concentration; mass spectrometry confirms identity. |
BC Research Inc. is a privately owned Canadian process technology incubator, specializing in custom research, process development and technology commercialization. Headquartered in Vancouver, British Columbia, BC Research operates primarily from their Technology Commercialization and Innovation Centre on Mitchell Island in the Vancouver suburb of Richmond. This 40,000 sq-ft facility includes a 28,000 sq-ft pilot plant development area, 2,500 sq-ft laboratory space, 9,000 sq-ft of office space, as well as a small machine shop and fenced outdoor piloting space. Technologies are scaled up from concept to pilot or demonstration scale in preparation for commercialization. Engineering support is provided by sister companies NORAM Engineering and Constructors Ltd. Previously, BC Research was located at the BC Research and Innovation Complex at the south end of the University of British Columbia campus. This facility closed in November 2007. The company specialized in consulting and applied research and development in the area of plant biotechnology and environment, health and safety, process and analysis, transportation and ship dynamics.
Many different amino acid side chains have been described as ADP-ribose acceptors. From a chemical perspective, this modification represents protein glycosylation: the transfer of ADP-ribose occurs onto amino acid side chains with a nucleophilic oxygen, nitrogen, or sulfur, resulting in N-, O-, or S-glycosidic linkage to the ribose of the ADP-ribose. Originally, acidic amino acids (glutamate and aspartate) were described as the main sites of ADP-ribosylation. However, many other ADP-ribose acceptor sites such as serine, arginine, cysteine, lysine, diphthamide, phosphoserine, and asparagine have been identified in subsequent works.
Kunitz-type serine protease inhibitor APEKTx1 is a peptide toxin derived from the sea anemone Anthopleura elegantissima. This toxin has a dual function, acting both as a serine protease inhibitor and as a selective and potent pore blocker of Kv1.1, a shaker related voltage-gated potassium channel. APEKTx1 is a potent toxin purified from the sea anemone A. elegantissima. Besides APEKTx1, other toxins such as APETx1, APE1-1, APE1-2, APE2-2, ApC, and APETx2 have been identified in A. elegantissima. This peptide has 65 amino acids crosslinked by 3 disulphide bridges, and has a molecular mass of 7475 Da. It acts as a monomer. The toxin belongs to the type 2 sea anemone peptides targeting voltage-gated K channels. Other type 2 toxins are the kalicludines from Anemonia sulcata, which selectively block Kv1.2 channels, and SHTX II from Stichodactyla haddoni. Structural homology is also shared with the basic pancreatic trypsin inhibitor (BPTI), a very potent Kunitz-type protease inhibitor, and dendrotoxins (DTX I and α-DTX), which are potent inhibitors of voltage-gated potassium channels.
Sources: en.wikipedia.org
Carnitine is an essential cofactor for mitochondrial transport of long‑chain fatty acids (a major lipid class) into the matrix for β‑oxidation. gamma-aminobutyric acid is a neurotransmitter. 5-HTP (5-hydroxytryptophan) is used for experimental treatment of depression. L-DOPA (L-dihydroxyphenylalanine) for Parkinson's treatment, Eflornithine inhibits ornithine decarboxylase and used in the treatment of sleeping sickness. Canavanine, an analogue of arginine found in many legumes is an antifeedant, protecting the plant from predators. Mimosine found in some legumes, is another possible antifeedant. This compound is an analogue of tyrosine and can poison animals that graze on these plants. However, not all of the functions of other abundant nonstandard amino acids are known.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Originally, seven such proteins were discovered. Of these, six (BMP2 through BMP7) belong to the Transforming growth factor beta superfamily of proteins. BMP1 is a metalloprotease. Since then, thirteen more BMPs, all of which are in the TGF-beta family, have been discovered, bringing the total to twenty. The current nomenclature only recognizes 13, as many others are put under the growth differentiation factor naming instead.
Sedimentation equilibrium experiments reports the molar mass of analytes and their chemical equilibrium constants. The rotor speed is adjusted such that a steady-state concentration profile c(r) of the sample in the cell is formed, where sedimentation and diffusion cancel out each other. Ultracentrifuge Gas centrifuge Theodor Svedberg Differential centrifugation Buoyant density ultracentrifugation Zippe-type centrifuge Reversible Associations in Structural and Molecular Biology (RASMB -an Analytical Ultracentrifugation Forum) Analytical Ultracentrifugation as a Contemporary Biomolecular Research Tool. Archived 2002-08-04 at the Wayback Machine Gilbert-Jenkins theory Archived 2007-05-01 at the Wayback Machine Report on an ultracentrifuge explosion.
Sources: en.wikipedia.org
Albiglutide (trade names Eperzan in Europe and Tanzeum in the US) is a glucagon-like peptide-1 agonist (GLP-1 agonist) drug marketed by GlaxoSmithKline (GSK) for treatment of type 2 diabetes. In 2017 GSK announced Albiglutide's withdrawal from the worldwide market for economic reasons, and remaining stocks in the supply chain were effectively depleted by 2018. Albiglutide was used for the treatment of type 2 diabetes in adults. It can be used alone (if metformin therapy is ineffective or not tolerated) or in combination with other antidiabetic drugs, including insulins. According to a 2015 analysis, albiglutide is less effective than other GLP-1 agonists for lowering glycated hemoglobin (HbA1c, an indicator for long-term blood glucose control) and weight loss. It also seems to have fewer side effects than most other drugs of this class, except for reactions at the injection site which are more common under albiglutide than, for example, under liraglutide.
Cabergoline was first synthesized by scientists working for the Italian drug company Farmitalia-Carlo Erba in Milan who were experimenting with semisynthetic derivatives of the ergot alkaloids, and a patent application was filed in 1980. The first publication was a scientific abstract at the Society for Neuroscience meeting in 1991. Farmitalia-Carlo Erba was acquired by Pharmacia in 1993, which in turn was acquired by Pfizer in 2003. Cabergoline was first marketed in The Netherlands as Dostinex in 1992. The drug was approved by the FDA on December 23, 1996. It went generic in late 2005 following US patent expiration. Brand names of cabergoline include Cabaser, Dostinex, Galastop (veterinary), and Kelactin (veterinary), among others. Cabergoline was studied in one person with Cushing's disease, to lower adrenocorticotropic hormone (ACTH) levels and cause regression of ACTH-producing pituitary adenomas. Substituted lysergamide Cabergoline – Isomer Design
A rare development is amyloid purpura, a susceptibility to bleeding with bruising around the eyes, termed "raccoon-eyes". Amyloid purpura is caused by amyloid deposition in the blood vessels and reduced activity of thrombin and factor X, two clotting proteins that lose their function after binding with amyloid. Amyloid deposits in tissue can cause enlargement of structures. Twenty percent of people with AL amyloidosis have an enlarged tongue, that can lead to obstructive sleep apnea, difficulty swallowing, and altered taste. Tongue enlargement does not occur in ATTR or AA amyloidosis. Deposition of amyloid in the throat can cause hoarseness.
Enzyme specificity refers to the interactions between any particular enzyme and its corresponding substrate. In addition to the specificity in binding its substrates, correct proximity and orientation as well as binding the transition state provide an additional layer of enzyme specificity. Enzymes vary in the specificity of the substrates that they bind to, in order to carry out specific physiological functions. Some enzymes may need to be less specific and therefore may bind to numerous substrates to catalyze a reaction. On the other hand, certain physiological functions require extreme specificity of the enzyme for a single specific substrate in order for a proper reaction and physiological phenotype to occur. The different types of categorizations differ based on their specificity for substrates. Most generally, they are divided into four groups: absolute, group, linkage, and stereochemical specificity.
Adenylyl cyclase is regulated by G proteins, which can be found in the monomeric form or the heterotrimeric form, consisting of three subunits. Adenylyl cyclase activity is controlled by heterotrimeric G proteins. The inactive or inhibitory form exists when the complex consists of alpha, beta, and gamma subunits, with GDP bound to the alpha subunit. In order to become active, a ligand must bind to the receptor and cause a conformational change. This conformational change causes the alpha subunit to dissociate from the complex and become bound to GTP. This G-alpha-GTP complex then binds to adenylyl cyclase and causes activation and the release of cAMP. Since a good signal requires the help of enzymes, which turn on and off signals quickly, there must also be a mechanism in which adenylyl cyclase deactivates and inhibits cAMP. The deactivation of the active G-alpha-GTP complex is accomplished rapidly by GTP hydrolysis due to the reaction being catalyzed by the intrinsic enzymatic activity of GTPase located in the alpha subunit. It is also regulated by forskolin, as well as other isoform-specific effectors:
Sources: en.wikipedia.org
It means adding liquid to a lyophilized peptide powder so it dissolves into solution. The dry powder is not a finished liquid product, and the resulting concentration depends on the volume added. Complete dissolution should be visually confirmed before use.
Some peptides have hydrophobic regions or strong charge interactions that make water a poor solvent alone. A small amount of organic solvent, acid, or base may be needed before aqueous dilution. The appropriate approach depends on sequence and should be based on documented compatibility.
No. Solutions can degrade through hydrolysis, oxidation, aggregation, and microbial growth, and stability varies widely by peptide. Storage at reduced temperature and avoidance of repeated freeze-thaw cycles are common laboratory practices. Specific shelf lives are determined by stability testing, not by a general rule.
It is the process of adding a liquid solvent to a dried peptide powder so that the peptide dissolves and forms a solution. The dried form is usually produced by lyophilization, and the solvent is chosen based on the peptide and the intended laboratory use.